ABHD5 (Human) Recombinant Protein (Q03)
| Specification | |
|---|---|
| Product Description | Human ABHD5 partial ORF ( AAH21958.1, 16 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
| Catalog # | PTG-H00051099-Q03 |
| Sell Price | 269.00 € |
| Size | 2 ug |
| Immunogen Sequence | RSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNK TPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAE |
| Type clonality | Protein |
| Application key | WB-Re,ELISA,AP,Array |
| Gene Alias | CDS|CGI58|IECN2|MGC8731|NCIE2 |
| Gene Description | abhydrolase domain containing 5 |
| Genbank Accession | BC021958 |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 |
| Storage Instruction | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Note | Best use within three months from the date of receipt of this protein. |
| Brand Name | Proteogenix |