ABTB1 (Human) Recombinant Protein (Q01)
| Specification | |
|---|---|
| Product Description | Human ABTB1 partial ORF ( NP_742024, 271 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal. |
| Catalog # | PTG-H00080325-Q01-25 |
| Sell Price | 543.00 € |
| Size | 25 ug |
| Immunogen Sequence | CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVF THVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR |
| Type clonality | Protein |
| Application key | WB-Re,ELISA,Array,AP |
| Gene Alias | BPOZ|Btb3|EF1ABP|MGC20585|PP2259 |
| Gene Description | ankyrin repeat and BTB (POZ) domain containing 1 |
| Genbank Accession | NM_172027 |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 |
| Storage Instruction | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Note | Best use within three months from the date of receipt of this protein. |
| Brand Name | Proteogenix |