ACSM3 (Human) Recombinant Protein (Q01)
| Specification | |
|---|---|
| Product Description | Human ACSM3 partial ORF ( NP_973729.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
| Catalog # | PTG-H00006296-Q01-25 |
| Sell Price | 543.00 € |
| Size | 25 ug |
| Immunogen Sequence | MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNF AKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEE |
| Type clonality | Protein |
| Application key | AP,Array,ELISA,WB-Re |
| Gene Alias | SA|SAH |
| Gene Description | acyl-CoA synthetase medium-chain family member 3 |
| Genbank Accession | NM_202000 |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 |
| Storage Instruction | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Note | Best use within three months from the date of receipt of this protein. |
| Brand Name | Proteogenix |